224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | COP9 signalosome complex subunit 8 |
|---|
Gene and Protein Information
| Gene ID | 10920 |
|---|---|
| Uniprot Accession IDs | Q99627 A8K1H6 Q53QS9 SGN8 |
| Ensembl ID | ENSP00000346340 |
| Symbol | CSN8 COP9 CSN8 SGN8 |
| Family | Belongs to the CSN8 family. |
| Sequence | MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 702097 | COPS8 | COP9 signalosome subunit 8 | 9544 | OMA, EggNOG | |
| Mouse | 108679 | Cops8 | COP9 signalosome subunit 8 | 10090 | MGI:1915363 | Inparanoid, OMA, EggNOG |
| Rat | 363283 | Cops8 | COP9 signalosome subunit 8 | 10116 | RGD:1311404 | Inparanoid, OMA, EggNOG |
| Dog | 477417 | COPS8 | COP9 signalosome subunit 8 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100057535 | COPS8 | COP9 signalosome subunit 8 | 9796 | VGNC:16778 | Inparanoid, OMA, EggNOG |
| Cow | 540493 | COPS8 | COP9 signalosome subunit 8 | 9913 | VGNC:27606 | Inparanoid, OMA, EggNOG |
| Pig | 100515865 | COPS8 | COP9 signalosome subunit 8 | 9823 | OMA, EggNOG | |
| Opossum | 100010441 | COPS8 | COP9 signalosome subunit 8 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100561349 | cops8 | COP9 signalosome subunit 8 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 394711 | cops8 | COP9 signalosome subunit 8 | 8364 | XB-GENE-5956805 | OMA, EggNOG |
| Zebrafish | 393198 | cops8 | COP9 signalosome subunit 8 | 7955 | ZDB-GENE-040426-982 | Inparanoid, OMA, EggNOG |
| Fruitfly | 49077 | CSN8 | COP9 signalosome subunit 8 | 7227 | FBgn0261437 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.