COPS8

DescripciónCOP9 signalosome complex subunit 8

Gene and Protein Information

Gene ID10920
Uniprot Accession IDs Q99627 A8K1H6 Q53QS9 SGN8
Ensembl ID ENSP00000346340
Symbol CSN8 COP9 CSN8 SGN8
FamilyBelongs to the CSN8 family.
Sequence
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque702097COPS8COP9 signalosome subunit 89544OMA, EggNOG
Mouse108679Cops8COP9 signalosome subunit 810090MGI:1915363Inparanoid, OMA, EggNOG
Rat363283Cops8COP9 signalosome subunit 810116RGD:1311404Inparanoid, OMA, EggNOG
Dog477417COPS8COP9 signalosome subunit 89615Inparanoid, OMA, EggNOG
Horse100057535COPS8COP9 signalosome subunit 89796VGNC:16778Inparanoid, OMA, EggNOG
Cow540493COPS8COP9 signalosome subunit 89913VGNC:27606Inparanoid, OMA, EggNOG
Pig100515865COPS8COP9 signalosome subunit 89823OMA, EggNOG
Opossum100010441COPS8COP9 signalosome subunit 813616Inparanoid, OMA, EggNOG
Anole lizard100561349cops8COP9 signalosome subunit 828377Inparanoid, OMA, EggNOG
Xenopus394711cops8COP9 signalosome subunit 88364XB-GENE-5956805OMA, EggNOG
Zebrafish393198cops8COP9 signalosome subunit 87955ZDB-GENE-040426-982Inparanoid, OMA, EggNOG
Fruitfly49077CSN8COP9 signalosome subunit 87227FBgn0261437Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.