224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Cyclic AMP-responsive element-binding protein 3 |
|---|
Gene and Protein Information
| Gene ID | 10488 |
|---|---|
| Uniprot Accession IDs | O43889 D0PTW6 O14671 O14919 Q5TCV1 Q96GK8 Q9H2W3 Q9UE77 CREB-3 |
| Ensembl ID | ENSP00000342136 |
| Symbol | LZIP LZIP LUMAN sLZIP |
| Family | Belongs to the bZIP family. ATF subfamily. |
| Sequence | MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 465081 | CREB3 | cAMP responsive element binding protein 3 | 9598 | VGNC:13867 | OMA, EggNOG |
| Macaque | 696350 | CREB3 | cAMP responsive element binding protein 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12913 | Creb3 | cAMP responsive element binding protein 3 | 10090 | MGI:99946 | Inparanoid, OMA, EggNOG |
| Dog | 611934 | CREB3 | cAMP responsive element binding protein 3 | 9615 | VGNC:39596 | Inparanoid, OMA, EggNOG |
| Horse | CREB3 | cAMP responsive element binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2347] | 9796 | OMA, EggNOG | ||
| Cow | 281715 | CREB3 | cAMP responsive element binding protein 3 | 9913 | VGNC:27693 | Inparanoid, OMA, EggNOG |
| Pig | 100142689 | CREB3 | cAMP responsive element binding protein 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 103104366 | CREB3 | cAMP responsive element binding protein 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100127204 | creb3 | cAMP responsive element binding protein 3 | 8364 | XB-GENE-959045 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.