🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CRTC3

DescripciónCREB-regulated transcription coactivator 3

Gene and Protein Information

Gene ID64784
Uniprot Accession IDs Q6UUV7 Q6DK61 Q6DK62 Q8NF38 Q9H6U2
Ensembl ID ENSP00000268184
Symbol TORC3 TORC3 TORC-3
FamilyBelongs to the TORC family.
Sequence
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp453648CRTC3CREB regulated transcription coactivator 39598VGNC:11847OMA, EggNOG
Macaque709458CRTC3CREB regulated transcription coactivator 39544Inparanoid, OMA, EggNOG
Mouse70461Crtc3CREB regulated transcription coactivator 310090MGI:1917711Inparanoid, OMA, EggNOG
Rat365297Crtc3CREB regulated transcription coactivator 310116RGD:1309666Inparanoid, OMA, EggNOG
Dog488747CRTC3CREB regulated transcription coactivator 39615VGNC:53163Inparanoid, OMA, EggNOG
Horse100068775CRTC3CREB regulated transcription coactivator 39796VGNC:50664Inparanoid, OMA, EggNOG
Cow540109CRTC3CREB regulated transcription coactivator 39913VGNC:27729Inparanoid, OMA, EggNOG
Opossum100013995CRTC3CREB regulated transcription coactivator 313616Inparanoid, EggNOG
Xenopus496857crtc3CREB regulated transcription coactivator 38364XB-GENE-5787077Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    basic leucine zipper transcription factor    /    CREB-related transcription factor    /    CREB-regulated transcription coactivator 3
DTO Classes
protein    /    Transcription factor    /    Basic leucine zipper transcription factor    /    CREB-regulated transcription coactivator 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.