🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CRTC3

DescripciónCREB-regulated transcription coactivator 3

Gene and Protein Information

Gene ID64784
Uniprot Accession IDs Q6UUV7 Q6DK61 Q6DK62 Q8NF38 Q9H6U2
Ensembl ID ENSP00000268184
Symbol TORC3 TORC3 TORC-3
FamilyBelongs to the TORC family.
Sequence
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp453648CRTC3CREB regulated transcription coactivator 39598VGNC:11847OMA, EggNOG
Macaque709458CRTC3CREB regulated transcription coactivator 39544Inparanoid, OMA, EggNOG
Mouse70461Crtc3CREB regulated transcription coactivator 310090MGI:1917711Inparanoid, OMA, EggNOG
Rat365297Crtc3CREB regulated transcription coactivator 310116RGD:1309666Inparanoid, OMA, EggNOG
Dog488747CRTC3CREB regulated transcription coactivator 39615VGNC:53163Inparanoid, OMA, EggNOG
Horse100068775CRTC3CREB regulated transcription coactivator 39796VGNC:50664Inparanoid, OMA, EggNOG
Cow540109CRTC3CREB regulated transcription coactivator 39913VGNC:27729Inparanoid, OMA, EggNOG
Opossum100013995CRTC3CREB regulated transcription coactivator 313616Inparanoid, EggNOG
Xenopus496857crtc3CREB regulated transcription coactivator 38364XB-GENE-5787077Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    basic leucine zipper transcription factor    /    CREB-related transcription factor    /    CREB-regulated transcription coactivator 3
DTO Classes
protein    /    Transcription factor    /    Basic leucine zipper transcription factor    /    CREB-regulated transcription coactivator 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.