🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ARF1

DescripciónADP-ribosylation factor 1

Gene and Protein Information

Gene ID375
Uniprot Accession IDs P84077 P10947 P32889
Ensembl ID ENSP00000440005
Symbol PVNH8
FamilyBelongs to the small GTPase superfamily. Arf family.
Sequence
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp739225ARF1ADP ribosylation factor 19598VGNC:52940OMA, EggNOG
Mouse11840Arf1ADP-ribosylation factor 110090MGI:99431Inparanoid, OMA
Rat64310Arf1ADP-ribosylation factor 110116RGD:621270Inparanoid, OMA
Cow338058ARF1ADP ribosylation factor 19913VGNC:50209Inparanoid, OMA
Pig100301914ARF1ADP ribosylation factor 19823Inparanoid, OMA
Chicken420398ARF1ADP ribosylation factor 19031CGNC:51247Inparanoid, OMA
Anole lizard100552859arf1ADP ribosylation factor 128377Inparanoid, OMA
Xenopus394614arf5ADP ribosylation factor 58364XB-GENE-968852Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.