🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

DCBLD2

DescripciónDiscoidin, CUB and LCCL domain-containing protein 2

Gene and Protein Information

Gene ID131566
Uniprot Accession IDs Q96PD2 B7WNL1 D3DN41 Q8N6M4 Q8TDX2
Ensembl ID ENSP00000321573
Symbol CLCP1 ESDN ESDN CLCP1
Sequence
MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460548DCBLD2discoidin, CUB and LCCL domain containing 29598VGNC:7055OMA, EggNOG
Macaque700151DCBLD2discoidin, CUB and LCCL domain containing 29544Inparanoid, OMA, EggNOG
Mouse73379Dcbld2discoidin, CUB and LCCL domain containing 210090MGI:1920629Inparanoid, OMA, EggNOG
Rat155696Dcbld2discoidin, CUB and LCCL domain containing 210116RGD:620543Inparanoid, OMA
Dog487949DCBLD2discoidin, CUB and LCCL domain containing 29615VGNC:39798Inparanoid, OMA, EggNOG
Horse100072384DCBLD2discoidin, CUB and LCCL domain containing 29796VGNC:17035Inparanoid, OMA, EggNOG
Cow524608DCBLD2discoidin, CUB and LCCL domain containing 29913VGNC:27909Inparanoid, OMA, EggNOG
Opossum100017786DCBLD2discoidin, CUB and LCCL domain containing 213616Inparanoid, OMA, EggNOG
PlatypusDCBLD2discoidin, CUB and LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:24627]9258OMA, EggNOG
Chicken418379DCBLD2discoidin, CUB and LCCL domain containing 29031CGNC:50750Inparanoid, OMA
Anole lizard100564847dcbld2discoidin, CUB and LCCL domain containing 228377Inparanoid, OMA
Zebrafish557649dcbld2discoidin, CUB and LCCL domain containing 27955ZDB-GENE-070112-1822Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.