🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HSD17B2

DescripciónEstradiol 17-beta-dehydrogenase 2

Gene and Protein Information

Gene ID3294
Uniprot Accession IDs P37059 B2R7T4
Ensembl ID ENSP00000199936
Symbol EDH17B2 SDR9C2 HSD17 SDR9C2 EDH17B2
FamilyBelongs to the short-chain dehydrogenases/reductases (SDR) family.
Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp454269HSD17B2hydroxysteroid 17-beta dehydrogenase 29598VGNC:13715OMA, EggNOG
Mouse15486Hsd17b2hydroxysteroid (17-beta) dehydrogenase 210090MGI:1096386Inparanoid, OMA, EggNOG
Rat79243Hsd17b2hydroxysteroid (17-beta) dehydrogenase 210116RGD:621803Inparanoid, OMA, EggNOG
Dog489690HSD17B2hydroxysteroid 17-beta dehydrogenase 29615VGNC:41805Inparanoid, OMA, EggNOG
Cow515710HSD17B2hydroxysteroid 17-beta dehydrogenase 29913VGNC:29973Inparanoid, OMA, EggNOG
Opossum100031815HSD17B2hydroxysteroid 17-beta dehydrogenase 213616Inparanoid, EggNOG
Platypus100076931HSD17B2hydroxysteroid 17-beta dehydrogenase 29258Inparanoid, OMA, EggNOG
Chicken415807HSD17B2hydroxysteroid 17-beta dehydrogenase 29031CGNC:4072Inparanoid, OMA, EggNOG
Xenopushsd17b2hydroxysteroid (17-beta) dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-1011810]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Estradiol 17-beta-dehydrogenase 2
protein    /    oxidoreductase    /    reductase    /    Estradiol 17-beta-dehydrogenase 2
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Estradiol 17-beta-dehydrogenase 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.