🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

DAPP1

DescripciónDual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Gene and Protein Information

Gene ID27071
Uniprot Accession IDs Q9UN19 Q8TCK5 Q9UHF2 hDAPP1
Ensembl ID ENSP00000423602
Symbol BAM32 BAM32
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp461398DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19598VGNC:10853OMA, EggNOG
Macaque709038DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19544Inparanoid, OMA, EggNOG
Mouse26377Dapp1dual adaptor for phosphotyrosine and 3-phosphoinositides 110090MGI:1347063Inparanoid, OMA, EggNOG
Rat362046Dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides 110116RGD:1310189Inparanoid, OMA, EggNOG
Dog478491DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19615VGNC:39773Inparanoid, OMA, EggNOG
Horse100053857DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19796VGNC:17010Inparanoid, OMA, EggNOG
Cow533156DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 19913VGNC:27880Inparanoid, OMA, EggNOG
Opossum100015430DAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 113616Inparanoid, OMA, EggNOG
PlatypusDAPP1dual adaptor of phosphotyrosine and 3-phosphoinositides 1 [Source:HGNC Symbol;Acc:HGNC:16500]9258OMA, EggNOG
Anole lizard100556013dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides 128377Inparanoid, OMA, EggNOG
Xenopus548440dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides8364XB-GENE-482064Inparanoid, OMA, EggNOG
Zebrafish550386dapp1dual adaptor of phosphotyrosine and 3-phosphoinositides7955ZDB-GENE-050417-180Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.