🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

DCTN3

DescripciónDynactin subunit 3

Gene and Protein Information

Gene ID11258
Uniprot Accession IDs O75935 A6NII7 B2RBM5 Q5T1I5 Q5T1I7 Q5T8G3 Q9BPU8
Ensembl ID ENSP00000259632
Symbol DCTN22 DCTN22 DCTN-22
FamilyBelongs to the dynactin subunit 3 family.
Sequence
MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAATQVKPAEE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp465061DCTN3dynactin subunit 39598VGNC:4706OMA, EggNOG
Macaque700703DCTN3dynactin subunit 39544OMA, EggNOG
Mouse53598Dctn3dynactin 310090MGI:1859251Inparanoid, OMA, EggNOG
Rat362504Dctn3dynactin subunit 310116RGD:1309547Inparanoid, OMA, EggNOG
Dog474750DCTN3dynactin subunit 39615VGNC:39818Inparanoid, OMA, EggNOG
Horse100068546DCTN3dynactin subunit 39796VGNC:17057Inparanoid, OMA, EggNOG
Cow514327DCTN3dynactin subunit 39913VGNC:27930Inparanoid, OMA, EggNOG
Pig100521815DCTN3dynactin subunit 39823OMA, EggNOG
Opossum100028844DCTN3dynactin subunit 313616Inparanoid, OMA, EggNOG
Chicken427404DCTN3dynactin subunit 39031CGNC:14543Inparanoid, OMA, EggNOG
Zebrafish431767dctn3dynactin 3 (p22)7955ZDB-GENE-040704-65Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.