CST3

DescripciónCystatin-C

Gene and Protein Information

Gene ID1471
Uniprot Accession IDs P01034 B2R5J9 D3DW42 Q6FGW9
Ensembl ID ENSP00000381448
Symbol ARMD11 HEL-S-2
FamilyBelongs to the cystatin family.
Sequence
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse13010Cst3cystatin C10090MGI:102519Inparanoid, OMA
Rat25307Cst3cystatin C10116RGD:2432Inparanoid, OMA, EggNOG
Dog607874LOC607874cystatin-C-like9615Inparanoid, OMA, EggNOG
HorseCST3cystatin C [Source:HGNC Symbol;Acc:HGNC:2475]9796OMA, EggNOG
Cow281102CST3cystatin C9913Inparanoid, OMA, EggNOG
Anole lizard100554354cst11cystatin 1128377OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.