🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

GEMIN2

DescripciónGem-associated protein 2

Gene and Protein Information

Gene ID8487
Uniprot Accession IDs O14893 B2R9W8 Q2M3B3 Q9H4F5 Q9NS77 Q9NS78 Q9NS79 Gemin-2
Ensembl ID ENSP00000308533
Symbol SIP1 SIP1 SIP1-delta
FamilyBelongs to the gemin-2 family.
Sequence
MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPELGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452873GEMIN2gem nuclear organelle associated protein 29598VGNC:3418OMA, EggNOG
Macaque698881GEMIN2gem nuclear organelle associated protein 29544OMA, EggNOG
Mouse66603Gemin2gem nuclear organelle associated protein 210090MGI:1913853Inparanoid, OMA, EggNOG
Rat84404Gemin2gem (nuclear organelle) associated protein 210116RGD:620842Inparanoid, OMA
Dog610087GEMIN2gem nuclear organelle associated protein 29615VGNC:41173Inparanoid, OMA, EggNOG
Horse100060834GEMIN2gem nuclear organelle associated protein 29796VGNC:18302Inparanoid, OMA, EggNOG
Cow510259GEMIN2gem nuclear organelle associated protein 29913VGNC:29316Inparanoid, OMA, EggNOG
Pig100525675GEMIN2gem nuclear organelle associated protein 29823OMA, EggNOG
Opossum100029358GEMIN2gem nuclear organelle associated protein 213616Inparanoid, EggNOG
Platypus100083035GEMIN2gem nuclear organelle associated protein 29258OMA, EggNOG
Chicken423336GEMIN2gem nuclear organelle associated protein 29031CGNC:7719Inparanoid, OMA, EggNOG
Anole lizard100559033gemin2gem nuclear organelle associated protein 228377Inparanoid, OMA, EggNOG
Xenopus100124782gemin2gem nuclear organelle associated protein 28364XB-GENE-941786OMA, EggNOG
Zebrafish550271gemin2gem (nuclear organelle) associated protein 27955ZDB-GENE-030131-3756Inparanoid, OMA, EggNOG
C. elegans189726smi-1SMN (survival of motor neuron) protein Interactor6239Inparanoid, OMA, EggNOG
Fruitfly40087Gem2Gemin27227FBgn0036850Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Gem-associated protein 2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Gem-associated protein 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.