224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Elongation factor Ts, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 10102 |
|---|---|
| Uniprot Accession IDs | P43897 B4E391 F5H2T7 Q561V7 Q8TBC2 Q9UQK0 EF-Ts |
| Ensembl ID | ENSP00000313877 |
| Symbol | EFTS EFTSMT |
| Family | Belongs to the EF-Ts family. |
| Sequence | MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVEVNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452028 | TSFM | Ts translation elongation factor, mitochondrial | 9598 | VGNC:14418 | OMA, EggNOG |
| Macaque | 715916 | TSFM | Ts translation elongation factor, mitochondrial | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66399 | Tsfm | Ts translation elongation factor, mitochondrial | 10090 | MGI:1913649 | Inparanoid, OMA, EggNOG |
| Rat | 679068 | Tsfm | Ts translation elongation factor, mitochondrial | 10116 | RGD:1593058 | Inparanoid, OMA |
| Horse | 100053864 | TSFM | Ts translation elongation factor, mitochondrial | 9796 | VGNC:24576 | Inparanoid, OMA, EggNOG |
| Cow | 281551 | TSFM | Ts translation elongation factor, mitochondrial | 9913 | VGNC:36413 | Inparanoid, OMA, EggNOG |
| Opossum | 100031520 | TSFM | Ts translation elongation factor, mitochondrial | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100566410 | tsfm | Ts translation elongation factor, mitochondrial | 28377 | OMA, EggNOG | |
| Xenopus | tsfm | Ts translation elongation factor, mitochondrial [Source:Xenbase;Acc:XB-GENE-964861] | 8364 | OMA, EggNOG | ||
| Zebrafish | 567785 | tsfm | Ts translation elongation factor, mitochondrial | 7955 | ZDB-GENE-061215-17 | Inparanoid, OMA, EggNOG |
| C. elegans | 179683 | tsfm-1 | Elongation factor Ts, mitochondrial | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 35060 | CG6412 | CG6412 gene product from transcript CG6412-RA | 7227 | FBgn0032646 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / guanyl-nucleotide exchange factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / translation elongation factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / guanyl-nucleotide exchange factor / Elongation factor Ts, mitochondrial
protein / nucleic acid binding / translation elongation factor / Elongation factor Ts, mitochondrial
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation elongation factor / Elongation factor Ts, mitochondrial
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation elongation factor / Elongation factor Ts, mitochondrial
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.