🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PTPN7

DescripciónTyrosine-protein phosphatase non-receptor type 7

Gene and Protein Information

Gene ID5778
Uniprot Accession IDs P35236 B3KXE1 Q53XK4 Q5SXQ0 Q5SXQ1 Q9BV05
Ensembl ID ENSP00000309116
Symbol LPTP HEPTP PTPNI BPTP-4 LC-PTP
FamilyBelongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.
Sequence
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp739158PTPN7protein tyrosine phosphatase, non-receptor type 79598VGNC:9887OMA, EggNOG
Macaque706254PTPN7protein tyrosine phosphatase, non-receptor type 79544Inparanoid, OMA, EggNOG
Mouse320139Ptpn7protein tyrosine phosphatase, non-receptor type 710090MGI:2156893Inparanoid, OMA, EggNOG
Rat246781Ptpn7protein tyrosine phosphatase, non-receptor type 710116RGD:708516Inparanoid, OMA, EggNOG
Dog607227PTPN7protein tyrosine phosphatase, non-receptor type 79615VGNC:45180Inparanoid, OMA, EggNOG
Horse100052261PTPN7protein tyrosine phosphatase, non-receptor type 79796VGNC:22024Inparanoid, OMA, EggNOG
Cow614077PTPN7protein tyrosine phosphatase, non-receptor type 79913VGNC:33542Inparanoid, OMA, EggNOG
Opossum100014659PTPN7protein tyrosine phosphatase, non-receptor type 713616Inparanoid, OMA, EggNOG
Platypus100077157PTPN7protein tyrosine phosphatase, non-receptor type 79258Inparanoid, OMA, EggNOG
Anole lizard100567068ptpn7protein tyrosine phosphatase, non-receptor type 728377Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.