🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAB20

DescripciónRas-related protein Rab-20

Gene and Protein Information

Gene ID55647
Uniprot Accession IDs Q9NX57 Q5T9X5 Q9NX49
Ensembl ID ENSP00000267328
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse19332Rab20RAB20, member RAS oncogene family10090MGI:102789Inparanoid, OMA, EggNOG
Rat689377Rab20RAB20, member RAS oncogene family10116RGD:1593487Inparanoid, OMA, EggNOG
Dog485549RAB20RAB20, member RAS oncogene family9615VGNC:45260Inparanoid, OMA, EggNOG
HorseRAB20RAB20, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18260]9796OMA, EggNOG
Cow615760RAB20RAB20, member RAS oncogene family9913VGNC:33627Inparanoid, OMA, EggNOG
Pig100737446RAB20RAB20, member RAS oncogene family9823OMA, EggNOG
Opossum100023618RAB20RAB20, member RAS oncogene family13616Inparanoid, OMA, EggNOG
PlatypusRAB20RAB20, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18260]9258OMA, EggNOG
Chicken418753RAB20RAB20, member RAS oncogene family9031CGNC:12639Inparanoid, OMA, EggNOG
Anole lizard100552246rab20RAB20, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus550049rab20RAB20, member RAS oncogene family8364XB-GENE-494912Inparanoid, OMA, EggNOG
Zebrafish337199rab20RAB20, member RAS oncogene family7955ZDB-GENE-030131-9143Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.