🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

RAB35

DescripciónRas-related protein Rab-35

Gene and Protein Information

Gene ID11021
Uniprot Accession IDs Q15286 B2R6E0 B4E390
Ensembl ID ENSP00000229340
Symbol RAB1C RAY RAY H-ray RAB1C
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp104001711RAB35RAB35, member RAS oncogene family9598VGNC:13354OMA, EggNOG
Mouse77407Rab35RAB35, member RAS oncogene family10090MGI:1924657Inparanoid, OMA, EggNOG
Rat288700Rab35RAB35, member RAS oncogene family10116RGD:1306362Inparanoid, OMA
Dog611477RAB35RAB35, member RAS oncogene family9615VGNC:45278Inparanoid, OMA, EggNOG
Horse100053915RAB35RAB35, member RAS oncogene family9796VGNC:22111Inparanoid, OMA, EggNOG
Cow614521RAB35RAB35, member RAS oncogene family9913VGNC:33644Inparanoid, OMA, EggNOG
OpossumRAB35RAB35, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9774]13616Inparanoid, OMA, EggNOG
Chicken416983RAB35RAB35, member RAS oncogene family9031CGNC:5524Inparanoid, OMA, EggNOG
Anole lizard100553866rab35RAB35, member RAS oncogene family28377Inparanoid, OMA, EggNOG
Xenopus394615rab35RAB35, member RAS oncogene family8364XB-GENE-489018OMA, EggNOG
Zebrafish445154rab35bRAB35, member RAS oncogene family b7955ZDB-GENE-040801-62OMA, EggNOG
C. elegans176560rab-35RAB family6239Inparanoid, OMA
Fruitfly33014Rab35CG9575 gene product from transcript CG9575-RD7227FBgn0031090Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.