🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAB27B

DescripciónRas-related protein Rab-27B

Gene and Protein Information

Gene ID5874
Uniprot Accession IDs O00194 B2RAB0 Q9BZB6
Ensembl ID ENSP00000262094
Symbol C25KG
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp468542RAB27BRAB27B, member RAS oncogene family9598VGNC:13277OMA, EggNOG
Mouse80718Rab27bRAB27B, member RAS oncogene family10090MGI:1931295Inparanoid, OMA, EggNOG
Rat84590Rab27bRAB27B, member RAS oncogene family10116RGD:620114Inparanoid, OMA, EggNOG
Dog483974RAB27BRAB27B, member RAS oncogene family9615VGNC:45268Inparanoid, OMA, EggNOG
Horse100049861RAB27BRAB27B, member RAS oncogene family9796VGNC:22101Inparanoid, OMA, EggNOG
Cow282858RAB27BRAB27B, member RAS oncogene family9913VGNC:33634Inparanoid, OMA, EggNOG
Opossum100016702RAB27BRAB27B, member RAS oncogene family13616Inparanoid, OMA, EggNOG
Platypus100078959RAB27BRAB27B, member RAS oncogene family9258Inparanoid, OMA, EggNOG
Anole lizard100558750rab27bRAB27B, member RAS oncogene family28377Inparanoid, OMA
Xenopus448182rab27bRAB27B, member RAS oncogene family8364XB-GENE-491764Inparanoid, OMA
C. elegans173223aex-6hypothetical protein6239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.