RAP1B

DescripciónRas-related protein Rap-1b

Gene and Protein Information

Gene ID5908
Uniprot Accession IDs P61224 B2R5Z2 B4DQI8 B4DW74 B4DW94 P09526 Q502X3 Q5TZR4 Q6DCA1 Q6LES0
Ensembl ID ENSP00000250559
Symbol K-REV RAL1B
FamilyBelongs to the small GTPase superfamily. Ras family.
Sequence
MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452065RAP1BRAP1B, member of RAS oncogene family9598VGNC:10515Inparanoid, OMA, EggNOG
Macaque718171RAP1BRAP1B, member of RAS oncogene family9544Inparanoid, OMA, EggNOG
Mouse215449Rap1bRAS related protein 1b10090MGI:894315Inparanoid, OMA, EggNOG
Rat171337Rap1bRAP1B, member of RAS oncogene family10116RGD:620577Inparanoid, OMA
Dog608981RAP1BRAP1B, member of RAS oncogene family9615Inparanoid, OMA, EggNOG
Horse100052025RAP1BRAP1B, member of RAS oncogene family9796Inparanoid, OMA
Horse100058930RAP1ARAP1A, member of RAS oncogene family9796OMA, EggNOG
Cow327708RAP1BRAP1B, member of RAS oncogene family9913Inparanoid, OMA
Opossum100014092RAP1BRAP1B, member of RAS oncogene family13616Inparanoid, OMA, EggNOG
Platypus100079331RAP1BRAP1B, member of RAS oncogene family9258Inparanoid, OMA, EggNOG
Chicken417840RAP1BRAP1B, member of RAS oncogene family9031CGNC:50604Inparanoid, OMA, EggNOG
Xenopus493557rap1bRAP1B, member of RAS oncogene family8364XB-GENE-479036Inparanoid, OMA
Xenopus100124947rap1aRAP1A, member of RAS oncogene family8364XB-GENE-5801166OMA, EggNOG
Zebrafish321107rap1bRAP1B, member of RAS oncogene family7955ZDB-GENE-030131-9662Inparanoid, OMA
Zebrafish406714rap1abRAP1A, member of RAS oncogene family b7955ZDB-GENE-040426-2738OMA, EggNOG
C. elegans177709rap-1Ras-related protein Rap-16239OMA, EggNOG
Fruitfly38244Rap1Rap1 GTPase7227FBgn0004636Inparanoid, EggNOG
S.cerevisiae853056RSR1Ras family GTPase RSR14932S000003384OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    small GTPase    /    Ras-related protein Rap-1b
DTO Classes
protein    /    Enzyme modulator    /    G-protein    /    Small GTPase    /    Ras-related protein Rap-1b

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.