🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAB5A

DescripciónRas-related protein Rab-5A

Gene and Protein Information

Gene ID5868
Uniprot Accession IDs P20339 B4DJA5 Q6FI44
Ensembl ID ENSP00000273047
Symbol RAB5 RAB5
FamilyBelongs to the small GTPase superfamily. Rab family.
Sequence
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460217RAB5ARAB5A, member RAS oncogene family9598VGNC:9693OMA, EggNOG
Macaque697712RAB5ARAB5A, member RAS oncogene family9544Inparanoid, OMA, EggNOG
Mouse271457Rab5aRAB5A, member RAS oncogene family10090MGI:105926Inparanoid, OMA, EggNOG
Dog404008RAB5ARAB5A, member RAS oncogene family9615VGNC:45291Inparanoid, OMA, EggNOG
Horse100051997RAB5ARAB5A, member RAS oncogene family9796VGNC:22124Inparanoid, OMA, EggNOG
Cow539764RAB5ARAB5A, member RAS oncogene family9913VGNC:33658Inparanoid, OMA
Opossum100024447RAB5ARAB5A, member RAS oncogene family13616Inparanoid, OMA, EggNOG
PlatypusRAB5ARAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9783]9258OMA, EggNOG
Chicken420649RAB5ARAB5A, member RAS oncogene family9031CGNC:51310Inparanoid, OMA, EggNOG
Anole lizard100552994rab5aRAB5A, member RAS oncogene family28377Inparanoid, OMA
Xenopus493430rab5aRAB5A, member RAS oncogene family8364XB-GENE-482011Inparanoid, OMA, EggNOG
Zebrafish337737rab5aaRAB5A, member RAS oncogene family, a7955ZDB-GENE-030131-139OMA, EggNOG
Zebrafish393945rab5abRAB5A, member RAS oncogene family, b7955ZDB-GENE-040122-3Inparanoid, OMA
S.cerevisiae853884YPT52Rab family GTPase YPT524932S000001722OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.