🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RAVER2

DescripciónRibonucleoprotein PTB-binding 2

Gene and Protein Information

Gene ID55225
Uniprot Accession IDs Q9HCJ3 Q6P141 Q9NPV7
Ensembl ID ENSP00000360112
Symbol KIAA1579
Sequence
MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQQLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469344RAVER2ribonucleoprotein, PTB binding 29598VGNC:10033OMA, EggNOG
Macaque701724RAVER2ribonucleoprotein, PTB binding 29544Inparanoid, OMA, EggNOG
Mouse242570Raver2ribonucleoprotein, PTB-binding 210090MGI:2443623Inparanoid, OMA
Rat362551Raver2ribonucleoprotein, PTB-binding 210116RGD:1307610Inparanoid, OMA
Dog489556RAVER2ribonucleoprotein, PTB binding 29615VGNC:45387Inparanoid, OMA
Horse100069778RAVER2ribonucleoprotein, PTB binding 29796VGNC:22217Inparanoid, OMA
Cow522059RAVER2ribonucleoprotein, PTB binding 29913VGNC:33766Inparanoid, OMA, EggNOG
Opossum100031320RAVER2ribonucleoprotein, PTB binding 213616Inparanoid, OMA, EggNOG
Anole lizard100559526raver2ribonucleoprotein, PTB binding 228377Inparanoid, OMA
Xenopus780311raver2ribonucleoprotein, PTB binding 28364XB-GENE-919935Inparanoid, OMA, EggNOG
Zebrafish797613raver2ribonucleoprotein, PTB-binding 27955ZDB-GENE-090713-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Ribonucleoprotein PTB-binding 2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Ribonucleoprotein PTB-binding 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.