🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

RAVER2

DescripciónRibonucleoprotein PTB-binding 2

Gene and Protein Information

Gene ID55225
Uniprot Accession IDs Q9HCJ3 Q6P141 Q9NPV7
Ensembl ID ENSP00000360112
Symbol KIAA1579
Sequence
MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQQLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469344RAVER2ribonucleoprotein, PTB binding 29598VGNC:10033OMA, EggNOG
Macaque701724RAVER2ribonucleoprotein, PTB binding 29544Inparanoid, OMA, EggNOG
Mouse242570Raver2ribonucleoprotein, PTB-binding 210090MGI:2443623Inparanoid, OMA
Rat362551Raver2ribonucleoprotein, PTB-binding 210116RGD:1307610Inparanoid, OMA
Dog489556RAVER2ribonucleoprotein, PTB binding 29615VGNC:45387Inparanoid, OMA
Horse100069778RAVER2ribonucleoprotein, PTB binding 29796VGNC:22217Inparanoid, OMA
Cow522059RAVER2ribonucleoprotein, PTB binding 29913VGNC:33766Inparanoid, OMA, EggNOG
Opossum100031320RAVER2ribonucleoprotein, PTB binding 213616Inparanoid, OMA, EggNOG
Anole lizard100559526raver2ribonucleoprotein, PTB binding 228377Inparanoid, OMA
Xenopus780311raver2ribonucleoprotein, PTB binding 28364XB-GENE-919935Inparanoid, OMA, EggNOG
Zebrafish797613raver2ribonucleoprotein, PTB-binding 27955ZDB-GENE-090713-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Ribonucleoprotein PTB-binding 2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Ribonucleoprotein PTB-binding 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.