224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Rab9 effector protein with kelch motifs |
|---|
Gene and Protein Information
| Gene ID | 10244 |
|---|---|
| Uniprot Accession IDs | Q7Z6M1 A8K403 O00568 Q69YR2 Q6FHA4 Q6IBG7 Q6P092 Q86Y76 Q9BWB1 |
| Ensembl ID | ENSP00000362639 |
| Symbol | RAB9P40 p40 RAB9P40 bA65N13.1 |
| Sequence | MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMGKHVYIFGGMTPAGALDTMYQYHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 738599 | RABEPK | Rab9 effector protein with kelch motifs | 9598 | VGNC:13949 | OMA, EggNOG |
| Macaque | 712731 | RABEPK | Rab9 effector protein with kelch motifs | 9544 | Inparanoid, OMA | |
| Mouse | 227746 | Rabepk | Rab9 effector protein with kelch motifs | 10090 | MGI:2139530 | Inparanoid, OMA, EggNOG |
| Rat | 296649 | Rabepk | Rab9 effector protein with kelch motifs | 10116 | RGD:1310612 | Inparanoid, OMA, EggNOG |
| Dog | 609581 | RABEPK | Rab9 effector protein with kelch motifs | 9615 | VGNC:45302 | Inparanoid, OMA, EggNOG |
| Horse | 100070894 | RABEPK | Rab9 effector protein with kelch motifs | 9796 | VGNC:22135 | Inparanoid, OMA, EggNOG |
| Cow | 533613 | RABEPK | Rab9 effector protein with kelch motifs | 9913 | VGNC:33669 | Inparanoid, OMA, EggNOG |
| Pig | 100152056 | RABEPK | Rab9 effector protein with kelch motifs | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015902 | RABEPK | Rab9 effector protein with kelch motifs | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100558782 | rabepk | Rab9 effector protein with kelch motifs | 28377 | Inparanoid, EggNOG | |
| Xenopus | 100492747 | rabepk | Rab9 effector protein with kelch motifs | 8364 | XB-GENE-1009616 | Inparanoid, OMA, EggNOG |
| Zebrafish | 431756 | rabepk | Rab9 effector protein with kelch motifs | 7955 | ZDB-GENE-040704-52 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.