Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Calcipressin-1 |
|---|
Gene and Protein Information
| Gene ID | 1827 |
|---|---|
| Uniprot Accession IDs | P53805 D3DSF9 O00582 O00583 Q53XT0 Q6IBC6 Q7Z555 Q96R03 Q9BU69 Q9UF15 Q9UME4 |
| Ensembl ID | ENSP00000370527 |
| Symbol | ADAPT78 CSP1 DSC1 DSCR1 CSP1 DSC1 RCN1 DSCR1 MCIP1 ADAPT78 |
| Family | Belongs to the RCAN family. |
| Sequence | MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 697108 | RCAN1 | regulator of calcineurin 1 | 9544 | Inparanoid, OMA | |
| Mouse | 54720 | Rcan1 | regulator of calcineurin 1 | 10090 | MGI:1890564 | Inparanoid, OMA, EggNOG |
| Rat | 266766 | Rcan1 | regulator of calcineurin 1 | 10116 | RGD:631338 | Inparanoid, OMA, EggNOG |
| Dog | 607887 | RCAN1 | regulator of calcineurin 1 | 9615 | VGNC:45436 | Inparanoid, OMA, EggNOG |
| Horse | 100062432 | RCAN1 | regulator of calcineurin 1 | 9796 | VGNC:22262 | Inparanoid, OMA, EggNOG |
| Cow | 539640 | RCAN1 | regulator of calcineurin 1 | 9913 | VGNC:33820 | Inparanoid, OMA, EggNOG |
| Pig | 100511902 | RCAN1 | regulator of calcineurin 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100025606 | RCAN1 | regulator of calcineurin 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | RCAN1 | regulator of calcineurin 1 [Source:HGNC Symbol;Acc:HGNC:3040] | 9258 | OMA, EggNOG | ||
| Chicken | 418510 | RCAN1 | regulator of calcineurin 1 | 9031 | CGNC:11960 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559981 | rcan1 | regulator of calcineurin 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448016 | rcan1 | regulator of calcineurin 1 | 8364 | XB-GENE-489568 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445222 | rcan1a | regulator of calcineurin 1a | 7955 | ZDB-GENE-040801-135 | OMA, EggNOG |
| C. elegans | 175788 | rcan-1 | Calcipressin-like protein | 6239 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.