🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

EBAG9

DescripciónReceptor-binding cancer antigen expressed on SiSo cells

Gene and Protein Information

Gene ID9166
Uniprot Accession IDs O00559 A8K3N6 Q5Y8C7 Q6IB20 Q9BS76
Ensembl ID ENSP00000337675
Symbol RCAS1 EB9 PDAF
Sequence
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464339EBAG9estrogen receptor binding site associated, antigen, 99598OMA, EggNOG
Macaque699305EBAG9estrogen receptor binding site associated, antigen, 99544Inparanoid, OMA, EggNOG
Mouse55960Ebag9estrogen receptor-binding fragment-associated gene 910090MGI:1859920Inparanoid, OMA, EggNOG
Rat299864Ebag9estrogen receptor binding site associated, antigen, 910116RGD:1307293Inparanoid, OMA
Dog403500EBAG9estrogen receptor binding site associated, antigen, 99615VGNC:40174Inparanoid, OMA, EggNOG
Horse100064267EBAG9estrogen receptor binding site associated, antigen, 99796VGNC:17395Inparanoid, OMA, EggNOG
Cow538551EBAG9estrogen receptor binding site associated, antigen, 99913Inparanoid, OMA, EggNOG
Pig100156275EBAG9estrogen receptor binding site associated, antigen, 99823OMA, EggNOG
Opossum100024590EBAG9estrogen receptor binding site associated, antigen, 913616OMA, EggNOG
Platypus100075604EBAG9estrogen receptor binding site associated, antigen, 99258OMA, EggNOG
Anole lizard100566802ebag9estrogen receptor binding site associated, antigen, 928377Inparanoid, OMA, EggNOG
Xenopus549842ebag9estrogen receptor binding site associated, antigen, 98364XB-GENE-996539Inparanoid, OMA, EggNOG
Zebrafish394069ebag9estrogen receptor binding site associated, antigen, 97955ZDB-GENE-040426-1093Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.