The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
PLN Descripción Cardiac phospholamban
Gene and Protein Information Gene ID 5350 Uniprot Accession IDs P26678 PLB Ensembl ID ENSP00000350132 Symbol PLB PLB CMD1P CMH18 Family Belongs to the phospholamban family. Sequence MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Mouse 18821 Pln phospholamban 10090 MGI:97622 Inparanoid, OMA, EggNOG Rat 64672 Pln phospholamban 10116 RGD:619894 Inparanoid, OMA, EggNOG Dog 414755 PLN phospholamban 9615 VGNC:44700 Inparanoid, OMA, EggNOG Horse 100630668 PLN phospholamban 9796 VGNC:21584 Inparanoid, OMA, EggNOG Cow 100125240 PLN phospholamban 9913 VGNC:33038 Inparanoid, OMA, EggNOG Opossum 100617747 PLN phospholamban 13616 OMA, EggNOG Platypus 100093363 PLN phospholamban 9258 Inparanoid, OMA, EggNOG Chicken 396378 PLN phospholamban 9031 CGNC:11054 Inparanoid, OMA Anole lizard 100563710 pln phospholamban 28377 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.