Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Cytochrome b-c1 complex subunit 6, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 7388 |
|---|---|
| Uniprot Accession IDs | P07919 B2R4V9 D3DQ18 Q5TDF6 Q6LDB8 Q9BQ91 |
| Ensembl ID | ENSP00000309565 |
| Symbol | QCR6 UQCR8 |
| Family | Belongs to the UQCRH/QCR6 family. |
| Sequence | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742376 | LOC742376 | cytochrome b-c1 complex subunit 6, mitochondrial | 9598 | OMA, EggNOG | |
| Mouse | 66576 | Uqcrh | ubiquinol-cytochrome c reductase hinge protein | 10090 | MGI:1913826 | Inparanoid, OMA, EggNOG |
| Rat | 366448 | Uqcrh | ubiquinol-cytochrome c reductase hinge protein | 10116 | RGD:1305987 | Inparanoid, OMA, EggNOG |
| Dog | 608530 | UQCRH | ubiquinol-cytochrome c reductase hinge protein | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100051878 | LOC100051878 | cytochrome b-c1 complex subunit 6, mitochondrial | 9796 | OMA, EggNOG | |
| Cow | 613899 | UQCRH | ubiquinol-cytochrome c reductase hinge protein | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100524873 | LOC100524873 | cytochrome b-c1 complex subunit 6, mitochondrial | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 771939 | UQCRH | ubiquinol-cytochrome c reductase hinge protein | 9031 | CGNC:13054 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100560644 | LOC100560644 | cytochrome b-c1 complex subunit 6, mitochondrial | 28377 | OMA, EggNOG | |
| Zebrafish | 566723 | uqcrh | ubiquinol-cytochrome c reductase hinge protein | 7955 | ZDB-GENE-051030-93 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / oxidoreductase / reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
protein / oxidoreductase / reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
protein / Enzyme / Oxidoreductase / Reductase / Cytochrome b-c1 complex subunit 6, mitochondrial
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.