PSMB2

DescripciónProteasome subunit beta type-2

Gene and Protein Information

Gene ID5690
Uniprot Accession IDs P49721 D3DPS0 P31145 Q9BWZ9
Ensembl ID ENSP00000362334
Symbol HC7-I
FamilyBelongs to the peptidase T1B family.
Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469277PSMB2proteasome subunit beta 29598VGNC:11806Inparanoid, OMA, EggNOG
Macaque712193PSMB2proteasome subunit beta 29544Inparanoid, OMA, EggNOG
Mouse26445Psmb2proteasome (prosome, macropain) subunit, beta type 210090MGI:1347045Inparanoid, OMA, EggNOG
Rat29675Psmb2proteasome subunit beta 210116RGD:61874Inparanoid, OMA, EggNOG
Dog475338PSMB2proteasome subunit beta 29615VGNC:45095Inparanoid, OMA, EggNOG
Horse100055325PSMB2proteasome subunit beta 29796VGNC:21941Inparanoid, OMA, EggNOG
Cow516919PSMB2proteasome subunit beta 29913VGNC:33446Inparanoid, OMA, EggNOG
Platypus100077529PSMB2proteasome subunit beta 29258Inparanoid, OMA, EggNOG
Chicken419630PSMB2proteasome subunit beta 29031CGNC:66347Inparanoid, OMA
Anole lizard100566839psmb2proteasome subunit beta 228377Inparanoid, OMA, EggNOG
Xenopus496467psmb2proteasome subunit beta 28364XB-GENE-946101Inparanoid, OMA, EggNOG
Zebrafish436882psmb2proteasome subunit beta 27955ZDB-GENE-040718-353Inparanoid, OMA, EggNOG
C. elegans171975pbs-4Proteasome subunit beta type-26239Inparanoid, OMA
S.cerevisiae856731PRE1proteasome core particle subunit beta 44932S000000814Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.