224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Ubiquitin thioesterase OTU1 |
|---|
Gene and Protein Information
| Gene ID | 55432 |
|---|---|
| Uniprot Accession IDs | Q5VVQ6 B2RNX3 Q5VVQ5 Q6ZRS6 Q86T63 Q9P1L8 |
| Ensembl ID | ENSP00000326813 |
| Symbol | DUBA8 HIN7 OTUD2 DUBA8 OTUD2 PRO0907 |
| Sequence | MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 693769 | YOD1 | YOD1 deubiquitinase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 226418 | Yod1 | YOD1 deubiquitinase | 10090 | MGI:2442596 | Inparanoid, OMA, EggNOG |
| Rat | 363982 | Yod1 | YOD1 deubiquitinase | 10116 | RGD:1359726 | Inparanoid, OMA, EggNOG |
| Dog | 490268 | YOD1 | YOD1 deubiquitinase | 9615 | VGNC:48496 | Inparanoid, OMA, EggNOG |
| Horse | YOD1 | YOD1 deubiquitinase [Source:HGNC Symbol;Acc:HGNC:25035] | 9796 | OMA, EggNOG | ||
| Cow | 539931 | YOD1 | YOD1 deubiquitinase | 9913 | VGNC:37033 | Inparanoid, OMA, EggNOG |
| Pig | 100520400 | YOD1 | YOD1 deubiquitinase | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100616747 | YOD1 | YOD1 deubiquitinase | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077606 | YOD1 | YOD1 deubiquitinase | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100565916 | yod1 | YOD1 deubiquitinase | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100493203 | yod1 | YOD1 deubiquitinase | 8364 | XB-GENE-998960 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550411 | yod1 | YOD1 deubiquitinase | 7955 | ZDB-GENE-050417-217 | Inparanoid, OMA, EggNOG |
| Fruitfly | 38603 | CG4603 | CG4603 gene product from transcript CG4603-RC | 7227 | FBgn0035593 | Inparanoid, EggNOG |
| S.cerevisiae | 850500 | OTU1 | ubiquitin-specific protease OTU1 | 4932 | S000001850 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.