🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PYGO2

DescripciónPygopus homolog 2

Gene and Protein Information

Gene ID90780
Uniprot Accession IDs Q9BRQ0 Q8WYZ4 Q96CY2
Ensembl ID ENSP00000357442
Symbol 1190004M21Rik
Sequence
MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNPMGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPSLSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSPAAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469836PYGO2pygopus family PHD finger 29598VGNC:1480OMA, EggNOG
Macaque106992713PYGO2pygopus family PHD finger 29544OMA, EggNOG
Mouse68911Pygo2pygopus 210090MGI:1916161Inparanoid, OMA, EggNOG
Rat295251Pygo2pygopus family PHD finger 210116RGD:1308535Inparanoid, OMA, EggNOG
Dog490440PYGO2pygopus family PHD finger 29615VGNC:45227Inparanoid, OMA, EggNOG
Horse100063020PYGO2pygopus family PHD finger 29796VGNC:22065Inparanoid, OMA, EggNOG
Cow540401PYGO2pygopus family PHD finger 29913VGNC:33591Inparanoid, OMA, EggNOG
Pig100151902PBXIP1PBX homeobox interacting protein 19823OMA, EggNOG
Opossum100021360PYGO2pygopus family PHD finger 213616Inparanoid, OMA, EggNOG
Anole lizardPYGO2pygopus family PHD finger 2 [Source:HGNC Symbol;Acc:HGNC:30257]28377Inparanoid, OMA, EggNOG
Zebrafish613247pygo2pygopus homolog 2 (Drosophila)7955ZDB-GENE-050809-108Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.