🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PSMB10

DescripciónProteasome subunit beta type-10

Gene and Protein Information

Gene ID5699
Uniprot Accession IDs P40306 B2R5J4 Q5U098
Ensembl ID ENSP00000351314
Symbol LMP10 MECL1 LMP10 MECL1 beta2i
FamilyBelongs to the peptidase T1B family.
Sequence
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp743176PSMB10proteasome subunit beta 109598VGNC:13783OMA, EggNOG
Mouse19171Psmb10proteasome (prosome, macropain) subunit, beta type 1010090MGI:1096380Inparanoid, OMA, EggNOG
Rat291983Psmb10proteasome subunit beta 1010116RGD:1307428Inparanoid, OMA, EggNOG
Dog489749PSMB10proteasome subunit beta 109615Inparanoid, OMA, EggNOG
Horse100066381PSMB10proteasome subunit beta 109796Inparanoid, OMA, EggNOG
Cow282328PSMB10proteasome subunit beta 109913Inparanoid, OMA, EggNOG
Opossum100021740PSMB10proteasome subunit beta 1013616Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.