PSMB1

DescripciónProteasome subunit beta type-1

Gene and Protein Information

Gene ID5689
Uniprot Accession IDs P20618 B5BU76 Q9BWA8
Ensembl ID ENSP00000262193
Symbol PSC5 HC5 PSC5 PMSB1
FamilyBelongs to the peptidase T1B family.
Sequence
MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp473258PSMB1proteasome subunit beta 19598VGNC:3675OMA, EggNOG
Macaque696133PSMB1proteasome subunit beta 19544Inparanoid, OMA, EggNOG
Mouse19170Psmb1proteasome (prosome, macropain) subunit, beta type 110090MGI:104884Inparanoid, OMA, EggNOG
Rat94198Psmb1proteasome subunit beta 110116RGD:621092Inparanoid, OMA, EggNOG
Dog475040PSMB1proteasome subunit beta 19615VGNC:54344Inparanoid, OMA, EggNOG
Horse100051957PSMB1proteasome subunit beta 19796VGNC:21939Inparanoid, OMA, EggNOG
Cow514237PSMB1proteasome subunit beta 19913VGNC:33444Inparanoid, OMA, EggNOG
Pig100621969PSMB1proteasome subunit beta 19823Inparanoid, OMA, EggNOG
Opossum100032711PSMB1proteasome subunit beta 113616Inparanoid, OMA, EggNOG
Chicken421551PSMB1proteasome subunit beta 19031CGNC:8487Inparanoid, OMA, EggNOG
Anole lizard100551855psmb1proteasome subunit beta 128377Inparanoid, OMA, EggNOG
Xenopus394589psmb1proteasome subunit beta 18364XB-GENE-970603Inparanoid, OMA, EggNOG
Zebrafish445413psmb1proteasome subunit beta 17955ZDB-GENE-040618-2Inparanoid, OMA, EggNOG
C. elegans176161pbs-6Proteasome subunit beta type-16239Inparanoid, OMA
Fruitfly39855Prosbeta6Proteasome beta6 subunit7227FBgn0002284Inparanoid, OMA, EggNOG
S.cerevisiae852239PRE7proteasome core particle subunit beta 64932S000000137Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.