🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CNR2

DescripciónCannabinoid receptor 2

Gene and Protein Information

Gene ID1269
Uniprot Accession IDs P34972 C6ES44 Q4VBK8 Q5JRH7 Q6B0G7 Q6NSY0 CB-2
Ensembl ID ENSP00000363596
Symbol CB2A CB2B CB2 CX5 CB-2
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456625CNR2cannabinoid receptor 29598VGNC:6114OMA, EggNOG
Macaque711155CNR2cannabinoid receptor 29544Inparanoid, OMA, EggNOG
Mouse12802Cnr2cannabinoid receptor 2 (macrophage)10090MGI:104650Inparanoid, OMA, EggNOG
Rat57302Cnr2cannabinoid receptor 210116RGD:619713Inparanoid, OMA, EggNOG
Dog612289CNR2cannabinoid receptor 29615VGNC:39427Inparanoid, OMA, EggNOG
Horse100071536CNR2cannabinoid receptor 29796VGNC:16688Inparanoid, OMA, EggNOG
Cow539769CNR2cannabinoid receptor 29913VGNC:27530Inparanoid, OMA, EggNOG
Pig100621002CNR2cannabinoid receptor 29823OMA, EggNOG
Opossum100010312CNR2cannabinoid receptor 213616Inparanoid, OMA, EggNOG
Platypus100091779CNR2cannabinoid receptor 29258Inparanoid, OMA, EggNOG
Chicken428232CNR2cannabinoid receptor 29031CGNC:3023Inparanoid, EggNOG
Anole lizard100563830cnr2cannabinoid receptor 228377Inparanoid, OMA, EggNOG
Xenopus100498271cnr2cannabinoid receptor 28364XB-GENE-488004Inparanoid, OMA, EggNOG
Zebrafish795246cnr2cannabinoid receptor 27955ZDB-GENE-040702-7OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Cannabinoid receptor 2
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Cannabinoid receptor    /    Cannabinoid receptor 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.