🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PVALB

DescripciónParvalbumin alpha

Gene and Protein Information

Gene ID5816
Uniprot Accession IDs P20472 B2R4H7 P78378 Q4VB78 Q5R3Q9
Ensembl ID ENSP00000216200
Symbol D22S749
FamilyBelongs to the parvalbumin family.
Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque697272PVALBparvalbumin9544Inparanoid, OMA, EggNOG
Mouse19293Pvalbparvalbumin10090MGI:97821Inparanoid, OMA, EggNOG
Rat25269Pvalbparvalbumin10116RGD:3457Inparanoid, OMA, EggNOG
Dog481278PVALBparvalbumin9615VGNC:45214Inparanoid, OMA, EggNOG
Horse100069554PVALBparvalbumin9796VGNC:22051Inparanoid, OMA, EggNOG
Cow538603PVALBparvalbumin9913VGNC:33579Inparanoid, OMA, EggNOG
Pig100157265PVALBparvalbumin9823OMA, EggNOG
Opossum100025093PVALBparvalbumin13616Inparanoid, OMA
Chicken396459PVALBparvalbumin9031CGNC:49814OMA, EggNOG
Anole lizard100556781pvalbparvalbumin28377Inparanoid, OMA, EggNOG
Xenopus496550pvalbparvalbumin8364XB-GENE-942844OMA, EggNOG
Zebrafish402807pvalb7parvalbumin 77955ZDB-GENE-040718-285Inparanoid, OMA
Zebrafish402806pvalb6parvalbumin 67955ZDB-GENE-040912-95OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Parvalbumin alpha
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Parvalbumin alpha

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.