224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Tyrosine-protein phosphatase non-receptor type 1 |
|---|
Gene and Protein Information
| Gene ID | 5770 |
|---|---|
| Uniprot Accession IDs | P18031 Q5TGD8 Q9BQV9 Q9NQQ4 |
| Ensembl ID | ENSP00000360683 |
| Symbol | PTP1B PTP1B |
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class 1 subfamily. |
| Sequence | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469970 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9598 | VGNC:9943 | OMA, EggNOG |
| Macaque | 702016 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 19246 | Ptpn1 | protein tyrosine phosphatase, non-receptor type 1 | 10090 | MGI:97805 | Inparanoid, OMA, EggNOG |
| Rat | 24697 | Ptpn1 | protein tyrosine phosphatase, non-receptor type 1 | 10116 | RGD:61965 | Inparanoid, OMA, EggNOG |
| Dog | 477263 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9615 | VGNC:45167 | Inparanoid, OMA |
| Horse | 100052066 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9796 | VGNC:22010 | Inparanoid, OMA |
| Cow | 508658 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9913 | VGNC:33529 | Inparanoid, OMA |
| Pig | 396667 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9823 | Inparanoid, OMA | |
| Chicken | 395688 | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 | 9031 | CGNC:6062 | Inparanoid, OMA |
| Anole lizard | PTPN1 | protein tyrosine phosphatase, non-receptor type 1 [Source:HGNC Symbol;Acc:HGNC:9642] | 28377 | Inparanoid, OMA | ||
| Xenopus | 549875 | ptpn1 | protein tyrosine phosphatase, non-receptor type 1 | 8364 | XB-GENE-950442 | Inparanoid, OMA |
| Zebrafish | 30081 | ptpn1 | protein tyrosine phosphatase, non-receptor type 1 | 7955 | ZDB-GENE-980605-23 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.