🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PRDX5

DescripciónPeroxiredoxin-5, mitochondrial

Gene and Protein Information

Gene ID25824
Uniprot Accession IDs P30044 A6NC19 A6NG06 B7ZLJ4 B7ZVW3 Q14CK0 Q6IAF2 Q9UBU5 Q9UJU4 Q9UKX4
Ensembl ID ENSP00000265462
Symbol ACR1 PLP ACR1 B166 PRXV PMP20 PRDX6 prx-V SBBI10 AOEB166 HEL-S-55
FamilyBelongs to the peroxiredoxin family. Prx5 subfamily.
Sequence
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp743467PRDX5peroxiredoxin 59598VGNC:1031OMA, EggNOG
Mouse54683Prdx5peroxiredoxin 510090MGI:1859821Inparanoid, OMA, EggNOG
Rat113898Prdx5peroxiredoxin 510116RGD:71007Inparanoid, OMA, EggNOG
HorsePRDX5peroxiredoxin 5 [Source:HGNC Symbol;Acc:HGNC:9355]9796OMA, EggNOG
Cow282885PRDX5peroxiredoxin 59913VGNC:33303Inparanoid, OMA, EggNOG
Pig397273PRDX5peroxiredoxin 59823Inparanoid, OMA, EggNOG
OpossumPRDX5peroxiredoxin 5 [Source:HGNC Symbol;Acc:HGNC:9355]13616Inparanoid, OMA, EggNOG
Anole lizard100558243prdx5peroxiredoxin 528377Inparanoid, OMA, EggNOG
Xenopus100127718prdx5peroxiredoxin 58364XB-GENE-1006734Inparanoid, OMA, EggNOG
Zebrafish554105prdx5peroxiredoxin 57955ZDB-GENE-050522-159Inparanoid, OMA, EggNOG
Fruitfly3771951Prx5Peroxiredoxin 57227FBgn0038570Inparanoid, EggNOG
S.cerevisiae850799AHP1thioredoxin peroxidase AHP14932S000004099Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.