SRSF3

DescripciónSerine/arginine-rich splicing factor 3

Gene and Protein Information

Gene ID6428
Uniprot Accession IDs P84103 B4E241 O08831 P23152 Q5R3K0
Ensembl ID ENSP00000362820
Symbol SFRS3 SRP20 SFRS3 SRp20
FamilyBelongs to the splicing factor SR family.
Sequence
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp747921SRSF3serine and arginine rich splicing factor 39598VGNC:52113OMA, EggNOG
Macaque719123SRSF3serine and arginine rich splicing factor 39544Inparanoid, OMA, EggNOG
Mouse20383Srsf3serine/arginine-rich splicing factor 310090MGI:98285Inparanoid, OMA, EggNOG
Rat361814Srsf3serine and arginine rich splicing factor 310116RGD:1309233Inparanoid, OMA
Dog403687SRSF3serine and arginine rich splicing factor 39615VGNC:46819Inparanoid, OMA, EggNOG
Horse100053744SRSF3serine and arginine rich splicing factor 39796VGNC:23601Inparanoid, OMA, EggNOG
Cow540276SRSF3serine and arginine rich splicing factor 39913VGNC:35301Inparanoid, OMA, EggNOG
Pig100739153SRSF3serine and arginine rich splicing factor 39823OMA, EggNOG
Opossum100026479SRSF3serine and arginine rich splicing factor 313616Inparanoid, OMA, EggNOG
Chicken419815SRSF3serine and arginine rich splicing factor 39031CGNC:329Inparanoid, OMA, EggNOG
Anole lizard100555138srsf3serine and arginine rich splicing factor 328377Inparanoid, OMA, EggNOG
Xenopus448605srsf3serine/arginine-rich splicing factor 38364XB-GENE-490817Inparanoid, OMA, EggNOG
Zebrafish100145909srsf3bserine/arginine-rich splicing factor 3b7955ZDB-GENE-071005-2Inparanoid, OMA
Zebrafishsrsf3aserine/arginine-rich splicing factor 3a [Source:ZFIN;Acc:ZDB-GENE-030616-631]7955OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Serine/arginine-rich splicing factor 3
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Serine/arginine-rich splicing factor 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.