🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SRSF9

DescripciónSerine/arginine-rich splicing factor 9

Gene and Protein Information

Gene ID8683
Uniprot Accession IDs Q13242 Q52LD1
Ensembl ID ENSP00000229390
Symbol SFRS9 SRP30C SFRS9 SRp30c
FamilyBelongs to the splicing factor SR family.
Sequence
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp742440SRSF9serine and arginine rich splicing factor 99598VGNC:14417OMA, EggNOG
Macaque697191SRSF9serine and arginine rich splicing factor 99544Inparanoid, OMA, EggNOG
Mouse108014Srsf9serine/arginine-rich splicing factor 910090MGI:104896Inparanoid, OMA, EggNOG
Rat288701Srsf9serine and arginine rich splicing factor 910116RGD:1309495Inparanoid, OMA
Dog477510SRSF9serine and arginine rich splicing factor 99615VGNC:52970Inparanoid, OMA, EggNOG
HorseSRSF9serine and arginine rich splicing factor 9 [Source:HGNC Symbol;Acc:HGNC:10791]9796OMA, EggNOG
Cow509905SRSF9serine and arginine rich splicing factor 99913VGNC:52832OMA, EggNOG
Pig100154637SRSF9serine and arginine rich splicing factor 99823Inparanoid, OMA, EggNOG
Opossum100617113SRSF9serine and arginine rich splicing factor 913616Inparanoid, OMA, EggNOG
Anole lizard100556727srsf9serine and arginine rich splicing factor 928377Inparanoid, OMA, EggNOG
Xenopus448015srsf9serine/arginine-rich splicing factor 98364XB-GENE-491310Inparanoid, OMA, EggNOG
Zebrafish405835srsf9serine/arginine-rich splicing factor 97955ZDB-GENE-040426-2397Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Serine/arginine-rich splicing factor 9
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Serine/arginine-rich splicing factor 9

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.