Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | SUMO-activating enzyme subunit 1 |
|---|
Gene and Protein Information
| Gene ID | 10055 |
|---|---|
| Uniprot Accession IDs | Q9UBE0 B2RDP5 B3KMQ2 F5GXX7 G3XAK6 O95717 Q9P020 |
| Ensembl ID | ENSP00000270225 |
| Symbol | AOS1 SUA1 UBLE1A AOS1 SUA1 UBLE1A HSPC140 |
| Family | Belongs to the ubiquitin-activating E1 family. |
| Sequence | MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456159 | SAE1 | SUMO1 activating enzyme subunit 1 | 9598 | VGNC:2259 | OMA, EggNOG |
| Macaque | 717918 | SAE1 | SUMO1 activating enzyme subunit 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 56459 | Sae1 | SUMO1 activating enzyme subunit 1 | 10090 | MGI:1929264 | Inparanoid, OMA, EggNOG |
| Rat | 308384 | Sae1 | SUMO1 activating enzyme subunit 1 | 10116 | RGD:1306098 | Inparanoid, OMA, EggNOG |
| Dog | 476425 | SAE1 | SUMO1 activating enzyme subunit 1 | 9615 | VGNC:45843 | Inparanoid, OMA, EggNOG |
| Horse | 100071215 | SAE1 | SUMO1 activating enzyme subunit 1 | 9796 | VGNC:22666 | Inparanoid, OMA, EggNOG |
| Cow | 505512 | SAE1 | SUMO1 activating enzyme subunit 1 | 9913 | VGNC:34261 | Inparanoid, OMA, EggNOG |
| Pig | 100515263 | SAE1 | SUMO1 activating enzyme subunit 1 | 9823 | OMA, EggNOG | |
| Opossum | 100016572 | SAE1 | SUMO1 activating enzyme subunit 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100093563 | SAE1 | SUMO1 activating enzyme subunit 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100563027 | sae1 | SUMO1 activating enzyme subunit 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549624 | sae1 | SUMO1 activating enzyme subunit 1 | 8364 | XB-GENE-923356 | Inparanoid, OMA, EggNOG |
| Zebrafish | 415148 | sae1 | SUMO1 activating enzyme subunit 1 | 7955 | ZDB-GENE-040625-21 | Inparanoid, OMA, EggNOG |
| C. elegans | 179409 | aos-1 | SUMO-activating enzyme subunit aos-1 | 6239 | Inparanoid, OMA | |
| Fruitfly | 41532 | Aos1 | Activator of SUMO 1 | 7227 | FBgn0029512 | Inparanoid, EggNOG |
| S.cerevisiae | 856310 | AOS1 | E1 ubiquitin-activating protein AOS1 | 4932 | S000006384 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.