🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SAA2

DescripciónSerum amyloid A-2 protein

Gene and Protein Information

Gene ID6289
Uniprot Accession IDs P0DJI9 G3XAK9 P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA2
Ensembl ID ENSP00000436126
Symbol SAA SAA1
FamilyBelongs to the SAA family.
Sequence
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp748829SAA2serum amyloid A29598VGNC:1010OMA, EggNOG
Mouse20209Saa2serum amyloid A 210090MGI:98222Inparanoid, OMA, EggNOG
Dog751814SAA1serum amyloid A19615Inparanoid, OMA
HorseSAAEquus caballus serum amyloid A1 (SAA), mRNA. [Source:RefSeq mRNA;Acc:NM_001081853]9796OMA, EggNOG
Cow506412SAA2serum amyloid A29913OMA, EggNOG
Pig100525680SAA2serum amyloid A-2 protein9823OMA, EggNOG
Zebrafish449557saaserum amyloid A7955ZDB-GENE-040927-15OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transfer/carrier protein    /    defense/immunity protein    /    Serum amyloid A-2 protein
protein    /    transfer/carrier protein    /    apolipoprotein    /    Serum amyloid A-2 protein
protein    /    transfer/carrier protein    /    transporter    /    Serum amyloid A-2 protein
DTO Classes
protein    /    Transporter    /    Apolipoprotein    /    Serum amyloid A-2 protein

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.