Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
Gene and Protein Information
| Gene ID | 6715 |
|---|---|
| Uniprot Accession IDs | P18405 B2R7Q1 Q9UHY4 Q9UP36 Q9UP37 |
| Ensembl ID | ENSP00000274192 |
| Symbol | S5AR 1 |
| Family | Belongs to the steroid 5-alpha reductase family. |
| Sequence | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 743740 | SRD5A1 | steroid 5 alpha-reductase 1 | 9598 | VGNC:7155 | OMA, EggNOG |
| Macaque | 695103 | SRD5A1 | steroid 5 alpha-reductase 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 78925 | Srd5a1 | steroid 5 alpha-reductase 1 | 10090 | MGI:98400 | Inparanoid, OMA, EggNOG |
| Rat | 24950 | Srd5a1 | steroid 5 alpha-reductase 1 | 10116 | RGD:3757 | Inparanoid, OMA, EggNOG |
| Dog | 403716 | SRD5A1 | steroid 5 alpha-reductase 1 | 9615 | VGNC:46793 | Inparanoid, OMA, EggNOG |
| Horse | 100071450 | SRD5A1 | steroid 5 alpha-reductase 1 | 9796 | VGNC:23573 | Inparanoid, OMA, EggNOG |
| Cow | 614612 | SRD5A1 | steroid 5 alpha-reductase 1 | 9913 | VGNC:35271 | Inparanoid, OMA, EggNOG |
| Pig | 100518046 | SRD5A1 | steroid 5 alpha-reductase 1 | 9823 | OMA, EggNOG | |
| Opossum | 100018123 | SRD5A1 | steroid 5 alpha-reductase 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 770453 | SRD5A1 | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) | 9031 | CGNC:56034 | OMA, EggNOG |
| Xenopus | 448586 | srd5a1 | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) | 8364 | XB-GENE-1000046 | Inparanoid, OMA, EggNOG |
| Zebrafish | 767715 | srd5a1 | steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) | 7955 | ZDB-GENE-060929-938 | Inparanoid, EggNOG |
| C. elegans | 184699 | F19H6.4 | hypothetical protein | 6239 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Enzyme / Oxidoreductase / Dehydrogenase / 3-oxo-5-alpha-steroid 4-dehydrogenase 1
protein / Enzyme / Oxidoreductase / Dehydrogenase / 3-oxo-5-alpha-steroid 4-dehydrogenase 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.