Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Runt-related transcription factor 3 |
|---|
Gene and Protein Information
| Gene ID | 864 |
|---|---|
| Uniprot Accession IDs | Q13761 B1AJV5 Q12969 Q13760 |
| Ensembl ID | ENSP00000382800 |
| Symbol | AML2 CBFA3 PEBP2A3 AML2 CBFA3 PEBP2aC |
| Sequence | MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 456633 | RUNX3 | runt related transcription factor 3 | 9598 | VGNC:6989 | OMA, EggNOG |
| Macaque | 719447 | RUNX3 | runt related transcription factor 3 | 9544 | OMA, EggNOG | |
| Mouse | 12399 | Runx3 | runt related transcription factor 3 | 10090 | MGI:102672 | Inparanoid, OMA, EggNOG |
| Rat | 156726 | Runx3 | runt-related transcription factor 3 | 10116 | RGD:620082 | Inparanoid, OMA |
| Dog | RUNX3 | runt related transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:10473] | 9615 | OMA, EggNOG | ||
| Horse | 100071400 | RUNX3 | runt related transcription factor 3 | 9796 | VGNC:22630 | Inparanoid, OMA, EggNOG |
| Cow | 617389 | RUNX3 | runt related transcription factor 3 | 9913 | VGNC:34221 | Inparanoid, OMA, EggNOG |
| Anole lizard | RUNX3 | runt related transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:10473] | 28377 | Inparanoid, OMA, EggNOG | ||
| Xenopus | 100485729 | runx3 | runt related transcription factor 3 | 8364 | XB-GENE-487784 | Inparanoid, OMA, EggNOG |
| Zebrafish | 58127 | runx3 | runt-related transcription factor 3 | 7955 | ZDB-GENE-000605-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.