🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

S100A1

DescripciónProtein S100-A1

Gene and Protein Information

Gene ID6271
Uniprot Accession IDs P23297 B2R5D9 Q5T7Y3
Ensembl ID ENSP00000292169
Symbol S100A S100 S100A S100-alpha
FamilyBelongs to the S-100 family.
Sequence
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457325S100A1S100 calcium binding protein A19598VGNC:3830OMA, EggNOG
MacaqueS100A1S100 calcium binding protein A1 [Source:HGNC Symbol;Acc:HGNC:10486]9544Inparanoid, OMA, EggNOG
Mouse20193S100a1S100 calcium binding protein A110090MGI:1338917Inparanoid, OMA, EggNOG
Rat295214S100a1S100 calcium binding protein A110116RGD:3614Inparanoid, OMA, EggNOG
Horse100056352S100A1S100 calcium binding protein A19796VGNC:22645Inparanoid, OMA, EggNOG
Cow528735S100A1S100 calcium binding protein A19913VGNC:34236Inparanoid, OMA, EggNOG
OpossumS100A1S100 calcium binding protein A1 [Source:HGNC Symbol;Acc:HGNC:10486]13616Inparanoid, OMA, EggNOG
Zebrafish448856s100a1S100 calcium binding protein A17955ZDB-GENE-040916-1Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-A1
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-A1
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-A1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.