Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Protein S100-A1 |
|---|
Gene and Protein Information
| Gene ID | 6271 |
|---|---|
| Uniprot Accession IDs | P23297 B2R5D9 Q5T7Y3 |
| Ensembl ID | ENSP00000292169 |
| Symbol | S100A S100 S100A S100-alpha |
| Family | Belongs to the S-100 family. |
| Sequence | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457325 | S100A1 | S100 calcium binding protein A1 | 9598 | VGNC:3830 | OMA, EggNOG |
| Macaque | S100A1 | S100 calcium binding protein A1 [Source:HGNC Symbol;Acc:HGNC:10486] | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 20193 | S100a1 | S100 calcium binding protein A1 | 10090 | MGI:1338917 | Inparanoid, OMA, EggNOG |
| Rat | 295214 | S100a1 | S100 calcium binding protein A1 | 10116 | RGD:3614 | Inparanoid, OMA, EggNOG |
| Horse | 100056352 | S100A1 | S100 calcium binding protein A1 | 9796 | VGNC:22645 | Inparanoid, OMA, EggNOG |
| Cow | 528735 | S100A1 | S100 calcium binding protein A1 | 9913 | VGNC:34236 | Inparanoid, OMA, EggNOG |
| Opossum | S100A1 | S100 calcium binding protein A1 [Source:HGNC Symbol;Acc:HGNC:10486] | 13616 | Inparanoid, OMA, EggNOG | ||
| Zebrafish | 448856 | s100a1 | S100 calcium binding protein A1 | 7955 | ZDB-GENE-040916-1 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Protein S100-A1
protein / calcium-binding protein / signaling molecule / Protein S100-A1
protein / calcium-binding protein / calmodulin / Protein S100-A1
protein / calcium-binding protein / signaling molecule / Protein S100-A1
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A1
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.