Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | U2 small nuclear ribonucleoprotein A' |
|---|
Gene and Protein Information
| Gene ID | 6627 |
|---|---|
| Uniprot Accession IDs | P09661 B2R5I6 Q8TBD2 U2 snRNP A' |
| Ensembl ID | ENSP00000254193 |
| Symbol | Lea1 U2A' |
| Family | Belongs to the U2 small nuclear ribonucleoprotein A family. |
| Sequence | MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 453692 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9598 | OMA, EggNOG | |
| Macaque | 694876 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9544 | OMA, EggNOG | |
| Mouse | 68981 | Snrpa1 | small nuclear ribonucleoprotein polypeptide A' | 10090 | MGI:1916231 | OMA, EggNOG |
| Rat | 100361269 | Snrpa1 | small nuclear ribonucleoprotein polypeptide A' | 10116 | RGD:2320494 | OMA, EggNOG |
| Dog | 607102 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9615 | VGNC:46610 | OMA, EggNOG |
| Horse | 100050337 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9796 | VGNC:23394 | OMA, EggNOG |
| Cow | 512584 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9913 | VGNC:35075 | OMA, EggNOG |
| Pig | 100156573 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9823 | OMA, EggNOG | |
| Platypus | 100085772 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9258 | OMA, EggNOG | |
| Chicken | 415523 | SNRPA1 | small nuclear ribonucleoprotein polypeptide A' | 9031 | CGNC:50006 | OMA, EggNOG |
| Anole lizard | 100568276 | snrpa1 | small nuclear ribonucleoprotein polypeptide A' | 28377 | OMA, EggNOG | |
| Zebrafish | 492511 | snrpa1 | small nuclear ribonucleoprotein polypeptide A' | 7955 | ZDB-GENE-041114-82 | OMA, EggNOG |
| C. elegans | 173767 | mog-2 | Probable U2 small nuclear ribonucleoprotein A' | 6239 | OMA, EggNOG | |
| Fruitfly | 35713 | U2A | CG1406 gene product from transcript CG1406-RA | 7227 | FBgn0033210 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein A'
protein / nucleic acid binding / mRNA splicing factor / U2 small nuclear ribonucleoprotein A'
DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein A'
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / U2 small nuclear ribonucleoprotein A'
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.