CRADD

DescripciónDeath domain-containing protein CRADD

Gene and Protein Information

Gene ID8738
Uniprot Accession IDs P78560 B7Z2Q5
Ensembl ID ENSP00000439068
Symbol RAIDD MRT34 RAIDD
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452128CRADDCASP2 and RIPK1 domain containing adaptor with death domain9598VGNC:8384OMA, EggNOG
Macaque711165CRADDCASP2 and RIPK1 domain containing adaptor with death domain9544Inparanoid, OMA, EggNOG
Mouse12905CraddCASP2 and RIPK1 domain containing adaptor with death domain10090MGI:1336168Inparanoid, OMA, EggNOG
Dog482604CRADDCASP2 and RIPK1 domain containing adaptor with death domain9615VGNC:39591Inparanoid, OMA, EggNOG
Cow615788CRADDCASP2 and RIPK1 domain containing adaptor with death domain9913Inparanoid, EggNOG
Opossum100011938CRADDCASP2 and RIPK1 domain containing adaptor with death domain13616Inparanoid, OMA, EggNOG
Platypus100073885CRADDCASP2 and RIPK1 domain containing adaptor with death domain9258Inparanoid, OMA, EggNOG
Chicken417900CRADDCASP2 and RIPK1 domain containing adaptor with death domain9031CGNC:8588Inparanoid, OMA, EggNOG
Anole lizardCRADDCASP2 and RIPK1 domain containing adaptor with death domain [Source:HGNC Symbol;Acc:HGNC:2340]28377Inparanoid, EggNOG
Xenopus448758cradd.1CASP2 and RIPK1 domain containing adaptor with death, gene 18364XB-GENE-5852262Inparanoid, OMA, EggNOG
Zebrafish450046craddCASP2 and RIPK1 domain containing adaptor with death domain7955ZDB-GENE-041010-168Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.