🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CRADD

DescripciónDeath domain-containing protein CRADD

Gene and Protein Information

Gene ID8738
Uniprot Accession IDs P78560 B7Z2Q5
Ensembl ID ENSP00000439068
Symbol RAIDD MRT34 RAIDD
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452128CRADDCASP2 and RIPK1 domain containing adaptor with death domain9598VGNC:8384OMA, EggNOG
Macaque711165CRADDCASP2 and RIPK1 domain containing adaptor with death domain9544Inparanoid, OMA, EggNOG
Mouse12905CraddCASP2 and RIPK1 domain containing adaptor with death domain10090MGI:1336168Inparanoid, OMA, EggNOG
Dog482604CRADDCASP2 and RIPK1 domain containing adaptor with death domain9615VGNC:39591Inparanoid, OMA, EggNOG
Cow615788CRADDCASP2 and RIPK1 domain containing adaptor with death domain9913Inparanoid, EggNOG
Opossum100011938CRADDCASP2 and RIPK1 domain containing adaptor with death domain13616Inparanoid, OMA, EggNOG
Platypus100073885CRADDCASP2 and RIPK1 domain containing adaptor with death domain9258Inparanoid, OMA, EggNOG
Chicken417900CRADDCASP2 and RIPK1 domain containing adaptor with death domain9031CGNC:8588Inparanoid, OMA, EggNOG
Anole lizardCRADDCASP2 and RIPK1 domain containing adaptor with death domain [Source:HGNC Symbol;Acc:HGNC:2340]28377Inparanoid, EggNOG
Xenopus448758cradd.1CASP2 and RIPK1 domain containing adaptor with death, gene 18364XB-GENE-5852262Inparanoid, OMA, EggNOG
Zebrafish450046craddCASP2 and RIPK1 domain containing adaptor with death domain7955ZDB-GENE-041010-168Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.