224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Signal recognition particle receptor subunit beta |
|---|
Gene and Protein Information
| Gene ID | 58477 |
|---|---|
| Uniprot Accession IDs | Q9Y5M8 Q6P595 Q8N2D8 SR-beta |
| Ensembl ID | ENSP00000418401 |
| Symbol | APMCF1 |
| Family | Belongs to the SRP receptor beta subunit family. |
| Sequence | MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100610929 | SRPRB | SRP receptor subunit beta | 9598 | VGNC:7126 | OMA, EggNOG |
| Macaque | 719024 | SRPRB | SRP receptor beta subunit | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20818 | Srprb | signal recognition particle receptor, B subunit | 10090 | MGI:102964 | Inparanoid, EggNOG |
| Cow | 100138613 | SRPRB | SRP receptor subunit beta | 9913 | VGNC:35291 | OMA, EggNOG |
| Pig | 100523141 | SRPRB | SRP receptor beta subunit | 9823 | OMA, EggNOG | |
| Opossum | 100617644 | SRPRB | SRP receptor beta subunit | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100092127 | SRPRB | SRP receptor beta subunit | 9258 | Inparanoid, EggNOG | |
| Zebrafish | 436845 | srprb | SRP receptor subunit beta | 7955 | ZDB-GENE-040718-311 | Inparanoid, OMA, EggNOG |
| Fruitfly | 47283 | SrpRbeta | Signal recognition particle receptor beta | 7227 | FBgn0011509 | Inparanoid, EggNOG |
| S.cerevisiae | 853702 | SRP102 | Signal recognition particle receptor subunit beta | 4932 | S000001637 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.