224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Serine racemase |
|---|
Gene and Protein Information
| Gene ID | 63826 |
|---|---|
| Uniprot Accession IDs | Q9GZT4 D3DTI5 Q6IA55 |
| Ensembl ID | ENSP00000339435 |
| Symbol | ILV1 ISO1 |
| Family | Belongs to the serine/threonine dehydratase family. |
| Sequence | MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 747543 | SRR | serine racemase | 9598 | VGNC:9655 | OMA, EggNOG |
| Macaque | SGSM2 | small G protein signaling modulator 2 [Source:HGNC Symbol;Acc:HGNC:29026] | 9544 | OMA, EggNOG | ||
| Mouse | 27364 | Srr | serine racemase | 10090 | MGI:1351636 | Inparanoid, OMA, EggNOG |
| Rat | 303306 | Srr | serine racemase | 10116 | RGD:735094 | Inparanoid, OMA, EggNOG |
| Horse | 100060209 | SRR | serine racemase | 9796 | VGNC:23594 | Inparanoid, OMA, EggNOG |
| Cow | 525340 | SRR | serine racemase | 9913 | VGNC:35292 | Inparanoid, OMA, EggNOG |
| Opossum | 100018989 | SRR | serine racemase | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 771635 | SRR | serine racemase | 9031 | CGNC:2288 | Inparanoid, OMA |
| Xenopus | 100144980 | srr | serine racemase | 8364 | XB-GENE-954863 | Inparanoid, OMA, EggNOG |
| C. elegans | 187970 | T01H8.2 | hypothetical protein | 6239 | OMA, EggNOG | |
| Fruitfly | 41117 | CG8129 | CG8129 gene product from transcript CG8129-RB | 7227 | FBgn0037684 | Inparanoid, EggNOG |
| S.cerevisiae | 853662 | SRY1 | threo-3-hydroxy-L-aspartate ammonia-lyase SRY1 | 4932 | S000001701 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / hydrolase / dehydratase / Serine racemase
protein / hydrolase / deaminase / Serine racemase
protein / hydrolase / epimerase/racemase / Serine racemase
protein / hydrolase / dehydratase / Serine racemase
protein / hydrolase / deaminase / Serine racemase
protein / hydrolase / epimerase/racemase / Serine racemase
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.