Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Protein sprouty homolog 4 |
|---|
Gene and Protein Information
| Gene ID | 81848 |
|---|---|
| Uniprot Accession IDs | Q9C004 A4FVB2 A4FVB3 Q6QIX2 Q9C003 Spry-4 |
| Ensembl ID | ENSP00000344967 |
| Symbol | HH17 |
| Family | Belongs to the sprouty family. |
| Sequence | MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471680 | SPRY4 | sprouty RTK signaling antagonist 4 | 9598 | VGNC:4179 | OMA, EggNOG |
| Macaque | 705836 | SPRY4 | sprouty RTK signaling antagonist 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 24066 | Spry4 | sprouty RTK signaling antagonist 4 | 10090 | MGI:1345144 | Inparanoid, OMA, EggNOG |
| Rat | 291610 | Spry4 | sprouty RTK signaling antagonist 4 | 10116 | RGD:1305324 | Inparanoid, OMA, EggNOG |
| Dog | 487192 | SPRY4 | sprouty RTK signaling antagonist 4 | 9615 | VGNC:46767 | Inparanoid, OMA, EggNOG |
| Horse | 100072121 | SPRY4 | sprouty RTK signaling antagonist 4 | 9796 | VGNC:23546 | Inparanoid, OMA, EggNOG |
| Cow | 504593 | SPRY4 | sprouty RTK signaling antagonist 4 | 9913 | VGNC:35244 | Inparanoid, OMA, EggNOG |
| Opossum | 100023167 | SPRY4 | sprouty RTK signaling antagonist 4 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100564505 | spry4 | sprouty RTK signaling antagonist 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100498065 | spry4 | sprouty RTK signaling antagonist 4 | 8364 | XB-GENE-480765 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114437 | spry4 | sprouty homolog 4 (Drosophila) | 7955 | ZDB-GENE-010803-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.