224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Steroid receptor RNA activator 1 |
|---|
Gene and Protein Information
| Gene ID | 10011 |
|---|---|
| Uniprot Accession IDs | Q9HD15 Q6NVU9 Q8IXM1 Q9HD13 Q9HD14 |
| Ensembl ID | ENSP00000337513 |
| Symbol | SRA SRAP STRAA1 pp7684 |
| Family | Belongs to the SRA1 family. |
| Sequence | MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737402 | SRA1 | steroid receptor RNA activator 1 | 9598 | VGNC:4181 | OMA, EggNOG |
| Macaque | 698169 | SRA1 | steroid receptor RNA activator 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 24068 | Sra1 | steroid receptor RNA activator 1 | 10090 | MGI:1344414 | Inparanoid, EggNOG |
| Rat | 252891 | Sra1 | steroid receptor RNA activator 1 | 10116 | RGD:621148 | Inparanoid, OMA, EggNOG |
| Dog | 606944 | SRA1 | steroid receptor RNA activator 1 | 9615 | VGNC:46788 | Inparanoid, OMA, EggNOG |
| Horse | 100072416 | SRA1 | steroid receptor RNA activator 1 | 9796 | VGNC:23568 | Inparanoid, OMA, EggNOG |
| Cow | 780787 | SRA1 | steroid receptor RNA activator 1 | 9913 | VGNC:35266 | Inparanoid, OMA, EggNOG |
| Pig | 100513784 | SRA1 | steroid receptor RNA activator 1 | 9823 | OMA, EggNOG | |
| Anole lizard | 100561561 | sra1 | steroid receptor RNA activator 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100135196 | sra1 | steroid receptor RNA activator 1 | 8364 | XB-GENE-994039 | Inparanoid, OMA, EggNOG |
| Zebrafish | 415137 | sra1 | steroid receptor RNA activator 1 | 7955 | ZDB-GENE-040625-6 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.