SRA1

DescripciónSteroid receptor RNA activator 1

Gene and Protein Information

Gene ID10011
Uniprot Accession IDs Q9HD15 Q6NVU9 Q8IXM1 Q9HD13 Q9HD14
Ensembl ID ENSP00000337513
Symbol SRA SRAP STRAA1 pp7684
FamilyBelongs to the SRA1 family.
Sequence
MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737402SRA1steroid receptor RNA activator 19598VGNC:4181OMA, EggNOG
Macaque698169SRA1steroid receptor RNA activator 19544Inparanoid, OMA, EggNOG
Mouse24068Sra1steroid receptor RNA activator 110090MGI:1344414Inparanoid, EggNOG
Rat252891Sra1steroid receptor RNA activator 110116RGD:621148Inparanoid, OMA, EggNOG
Dog606944SRA1steroid receptor RNA activator 19615VGNC:46788Inparanoid, OMA, EggNOG
Horse100072416SRA1steroid receptor RNA activator 19796VGNC:23568Inparanoid, OMA, EggNOG
Cow780787SRA1steroid receptor RNA activator 19913VGNC:35266Inparanoid, OMA, EggNOG
Pig100513784SRA1steroid receptor RNA activator 19823OMA, EggNOG
Anole lizard100561561sra1steroid receptor RNA activator 128377Inparanoid, OMA, EggNOG
Xenopus100135196sra1steroid receptor RNA activator 18364XB-GENE-994039Inparanoid, OMA, EggNOG
Zebrafish415137sra1steroid receptor RNA activator 17955ZDB-GENE-040625-6Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.