🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

RPL26L1

Descripción60S ribosomal protein L26-like 1

Gene and Protein Information

Gene ID51121
Uniprot Accession IDs Q9UNX3 B3KY82 D3DQM0
Ensembl ID ENSP00000428223
Symbol RPL26P1 RPL26P1
FamilyBelongs to the universal ribosomal protein uL24 family.
Sequence
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Pig100216316RPL26L1ribosomal protein L26 like 19823Inparanoid, OMA
Xenopus448683rpl26ribosomal protein L268364XB-GENE-967178Inparanoid, OMA
Zebrafish406387rpl26ribosomal protein L267955ZDB-GENE-040426-2117Inparanoid, OMA
C. elegans174379rpl-2660S ribosomal protein L266239Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribosomal protein    /    60S ribosomal protein L26-like 1
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Ribosomal protein    /    60S ribosomal protein L26-like 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.