🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

POLR2H

DescripciónDNA-directed RNA polymerases I, II, and III subunit RPABC3

Gene and Protein Information

Gene ID5437
Uniprot Accession IDs P52434 C9J413 C9JBJ6 C9JCU7 C9JUA8 P53802 Q969R0 RNA polymerases I, II, and III subunit ABC3
Ensembl ID ENSP00000415536
Symbol RPB8 RPB17 RPABC3
FamilyBelongs to the eukaryotic RPB8 RNA polymerase subunit family.
Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque100429040POLR2HRNA polymerase II subunit H9544Inparanoid, OMA
Mouse245841Polr2hpolymerase (RNA) II (DNA directed) polypeptide H10090MGI:2384309Inparanoid, OMA
Horse100059115POLR2HRNA polymerase II subunit H9796VGNC:21680Inparanoid, OMA
Cow505599POLR2HRNA polymerase II subunit H9913VGNC:33142Inparanoid, OMA
Pig100628241POLR2HRNA polymerase II subunit H9823Inparanoid, OMA
Opossum100013916POLR2HRNA polymerase II subunit H13616Inparanoid, OMA
Platypus100089660POLR2HRNA polymerase II subunit H9258Inparanoid, OMA
Chicken424954POLR2HRNA polymerase II subunit H9031CGNC:6474Inparanoid, OMA
Anole lizard100555951polr2hRNA polymerase II subunit H28377Inparanoid, OMA
Xenopus548867polr2hpolymerase (RNA) II subunit H8364XB-GENE-491773Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA-directed RNA polymerase    /    DNA-directed RNA polymerases I, II, and III subunit RPABC3
protein    /    nucleic acid binding    /    nucleotidyltransferase    /    DNA-directed RNA polymerases I, II, and III subunit RPABC3
DTO Classes
protein    /    Enzyme    /    Transferase    /    Nucleotidyltransferase    /    Polymerase    /    DNA-directed RNA polymerase    /    DNA-directed RNA polymerases I, II, and III subunit RPABC3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.