Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Ubiquitin-60S ribosomal protein L40 |
|---|
Gene and Protein Information
| Gene ID | 7311 |
|---|---|
| Uniprot Accession IDs | P62987 P02248 P02249 P02250 P14793 P62988 Q29120 Q6LBL4 Q6LDU5 Q8WYN8 Q91887 Q91888 Q9BWD6 Q9BX98 Q9UEF2 Q9UEG1 Q9UEK8 Q9UPK7 |
| Ensembl ID | ENSP00000388107 |
| Symbol | UBCEP2 L40 CEP52 RPL40 HUBCEP52 |
| Family | In the C-terminal section; belongs to the eukaryotic ribosomal protein eL40 family. |
| Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | UBA52 | - | 9544 | Inparanoid, OMA, EggNOG | ||
| Mouse | 22186 | Uba52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 10090 | MGI:98887 | Inparanoid, EggNOG |
| Rat | 64156 | Uba52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 10116 | RGD:68344 | Inparanoid, OMA |
| Dog | 403722 | UBA52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100071005 | UBA52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 9796 | VGNC:49290 | OMA, EggNOG |
| Cow | 615199 | UBA52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 9913 | VGNC:49988 | Inparanoid, OMA, EggNOG |
| Opossum | 100012532 | UBA52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077847 | UBA52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448705 | uba52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 8364 | XB-GENE-939925 | Inparanoid, OMA, EggNOG |
| Zebrafish | 641289 | uba52 | ubiquitin A-52 residue ribosomal protein fusion product 1 | 7955 | ZDB-GENE-051023-7 | Inparanoid, OMA, EggNOG |
| C. elegans | 176718 | ubq-2 | Ubiquitin | 6239 | Inparanoid, OMA | |
| Fruitfly | 33629 | RpL40 | Ribosomal protein L40 | 7227 | FBgn0003941 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / ribosomal protein / Ubiquitin-60S ribosomal protein L40
protein / nucleic acid binding / ribosomal protein / Ubiquitin-60S ribosomal protein L40
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Ubiquitin-60S ribosomal protein L40
protein / Nucleic acid binding / RNA binding protein / Ribosomal protein / Ubiquitin-60S ribosomal protein L40
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.