🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

UBA52

DescripciónUbiquitin-60S ribosomal protein L40

Gene and Protein Information

Gene ID7311
Uniprot Accession IDs P62987 P02248 P02249 P02250 P14793 P62988 Q29120 Q6LBL4 Q6LDU5 Q8WYN8 Q91887 Q91888 Q9BWD6 Q9BX98 Q9UEF2 Q9UEG1 Q9UEK8 Q9UPK7
Ensembl ID ENSP00000388107
Symbol UBCEP2 L40 CEP52 RPL40 HUBCEP52
FamilyIn the C-terminal section; belongs to the eukaryotic ribosomal protein eL40 family.
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
MacaqueUBA52-9544Inparanoid, OMA, EggNOG
Mouse22186Uba52ubiquitin A-52 residue ribosomal protein fusion product 110090MGI:98887Inparanoid, EggNOG
Rat64156Uba52ubiquitin A-52 residue ribosomal protein fusion product 110116RGD:68344Inparanoid, OMA
Dog403722UBA52ubiquitin A-52 residue ribosomal protein fusion product 19615Inparanoid, OMA, EggNOG
Horse100071005UBA52ubiquitin A-52 residue ribosomal protein fusion product 19796VGNC:49290OMA, EggNOG
Cow615199UBA52ubiquitin A-52 residue ribosomal protein fusion product 19913VGNC:49988Inparanoid, OMA, EggNOG
Opossum100012532UBA52ubiquitin A-52 residue ribosomal protein fusion product 113616Inparanoid, OMA, EggNOG
Platypus100077847UBA52ubiquitin A-52 residue ribosomal protein fusion product 19258Inparanoid, OMA, EggNOG
Xenopus448705uba52ubiquitin A-52 residue ribosomal protein fusion product 18364XB-GENE-939925Inparanoid, OMA, EggNOG
Zebrafish641289uba52ubiquitin A-52 residue ribosomal protein fusion product 17955ZDB-GENE-051023-7Inparanoid, OMA, EggNOG
C. elegans176718ubq-2Ubiquitin6239Inparanoid, OMA
Fruitfly33629RpL40Ribosomal protein L407227FBgn0003941Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribosomal protein    /    Ubiquitin-60S ribosomal protein L40
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Ribosomal protein    /    Ubiquitin-60S ribosomal protein L40

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.