Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Ribosome maturation protein SBDS |
|---|
Gene and Protein Information
| Gene ID | 51119 |
|---|---|
| Uniprot Accession IDs | Q9Y3A5 A8K0P4 Q96FX0 Q9NV53 |
| Ensembl ID | ENSP00000246868 |
| Symbol | SDS SWDS CGI-97 |
| Family | Belongs to the SDO1/SBDS family. |
| Sequence | MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463942 | SBDS | SBDS, ribosome maturation factor | 9598 | VGNC:8747 | OMA, EggNOG |
| Mouse | 66711 | Sbds | SBDS ribosome maturation factor | 10090 | MGI:1913961 | Inparanoid, OMA, EggNOG |
| Rat | 288615 | Sbds | SBDS, ribosome maturation factor | 10116 | RGD:1311043 | Inparanoid, OMA, EggNOG |
| Dog | 607017 | SBDS | SBDS, ribosome maturation factor | 9615 | VGNC:45881 | Inparanoid, OMA, EggNOG |
| Horse | 100060921 | SBDS | SBDS, ribosome maturation factor | 9796 | VGNC:22704 | Inparanoid, OMA, EggNOG |
| Cow | 513237 | SBDS | SBDS, ribosome maturation factor | 9913 | VGNC:34304 | Inparanoid, OMA, EggNOG |
| Pig | 100516003 | SBDS | SBDS, ribosome maturation factor | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010489 | SBDS | SBDS, ribosome maturation factor | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100093615 | SBDS | SBDS, ribosome maturation factor | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 417477 | SBDS | SBDS ribosome assembly guanine nucleotide exchange factor | 9031 | CGNC:749 | Inparanoid, OMA |
| Xenopus | 448365 | sbds | SBDS ribosome assembly guanine nucleotide exchange factor | 8364 | XB-GENE-1003506 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394096 | sbds | SBDS, ribosome maturation factor | 7955 | ZDB-GENE-040426-1116 | Inparanoid, OMA, EggNOG |
| C. elegans | 175218 | sbds-1 | Ribosome maturation protein SBDS | 6239 | Inparanoid, OMA | |
| Fruitfly | 38749 | CG8549 | CG8549 gene product from transcript CG8549-RA | 7227 | FBgn0035714 | Inparanoid, EggNOG |
| S.cerevisiae | 850709 | SDO1 | guanine nucleotide exchange factor SDO1 | 4932 | S000004012 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / transcription factor / Ribosome maturation protein SBDS
protein / nucleic acid binding / nuclease / Ribosome maturation protein SBDS
protein / nucleic acid binding / transcription factor / Ribosome maturation protein SBDS
protein / nucleic acid binding / nuclease / Ribosome maturation protein SBDS
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.