224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | C-C motif chemokine 4 |
|---|
Gene and Protein Information
| Gene ID | 6351 |
|---|---|
| Uniprot Accession IDs | P13236 P22617 Q13704 Q3SXL8 Q6FGI8 |
| Ensembl ID | ENSP00000482259 |
| Symbol | LAG1 MIP1B SCYA4 ACT2 G-26 HC21 LAG1 LAG-1 MIP1B SCYA2 SCYA4 MIP1B1 AT744.1 MIP-1-beta |
| Family | Belongs to the intercrine beta (chemokine CC) family. |
| Sequence | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Rat | 116637 | Ccl4 | C-C motif chemokine ligand 4 | 10116 | RGD:620441 | Inparanoid, OMA |
| Opossum | 100017283 | LOC100017283 | C-C motif chemokine 4-like | 13616 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.